Recombinant Human BNP

$70.00$4,680.00

Catalog Number:P1037-20ug
                                   P1037-100ug
                                   P1037-1mg

Description:

Natriuretic Peptide Precursor B acts as a cardiac hormone with a variety of biological actions including natriuresis, diuresis, vasorelaxation, and inhibition of renin and aldosterone secretion. It is thought to play a key role in cardiovascular homeostasis. Helps restore the body’s salt and water balance. Improves heart function.B-type Natriuretic Peptide Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 32 amino acids and having a molecular mass of 3464 Dalton.
NPPB is purified by proprietary chromatographic techniques.

Source:E.coli

Synonyms:NPPB, Natriuretic Peptide Precursor B, BNP, B-type Natriuretic Peptide.

AA Sequence:SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH.

Purity:

Greater than 95.0% as determined by:
(a) Analysis by RP-HPLC.
(b) Analysis by SDS-PAGE.

Usage:FOR RESEARCH USE ONLY

Note:The product is shipped at ambient temperature. Upon receipt, store it immediately at the temperature recommended below.

Clear
SKU: P1037 Category:

Additional information

Size

20ug, 100ug, 1mg