Recombinant Human HMGB1

$70.00$2,280.00

Catalog Number:P1173-10ug
                                   P1173-50ug
                                   P1173-1mg

Description:

High-mobility group box 1 protein (HMGB1), previously known as HMG-1 or amphoterin, is a member of the high mobility group box family of non-histone chromosomal proteins. Human HMGB1 is expressed as a 30 kDa, 215 amino acid (aa) single chain polypeptide containing three domains: two N-terminal globular, 70 aa positively charged DNA-binding domains (HMG boxes A and B), and a negatively charged 30 aa C-terminal region that contains only Asp and Glu.4, 5 Residues 27 – 43 and 178 – 184 contain a NLS. Posttranslational modifications of the molecule have been reported, with acetylation occurring on as many as 17 lysine residues. HMGB1 is expressed at high levels in almost all cells. It was originally discovered as a nuclear protein that could bend DNA. Such bending stabilizes nucleosome formation and regulates the expression of select genes upon recruitment by DNA binding proteins.HMG1 Human Recombinant fused with 6X His tag produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 223 amino acids and having a molecular mass of 26 kDa.
The HMGB-1 is purified by proprietary chromatographic techniques.

Source:E.coli

Synonyms:HMG1, HMG3, SBP-1, Amphoterin, HMGB1, High-Mobility Group Box 1.

AA Sequence:

MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKT
MSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFF
LFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKY
EKDIAAYRAKGKPDAAKKGVVKAEKSKKKEEEEDEEDEEDEEEEEDEEDEDE
EEDDDDELEHHHHHH.

Purity:

Greater than 95.0% as determined by:
(a) Analysis by RP-HPLC.
(b) Analysis by SDS-PAGE.

Biological Activity:

Measured by its ability to induce TNF-alpha secretion by RAW 264.7 mouse monocyte/macrophage cells. The ED50 for this effect is 2.5-12.5 μg/mL.

Usage:FOR RESEARCH USE ONLY

Note:The product is shipped at ambient temperature. Upon receipt, store it immediately at the temperature recommended below.

Clear
SKU: P1173 Category:

Additional information

Size

10ug, 50ug, 1mg