Recombinant Human IL-12 p70 (CHO derived)

$75.00$180.00

Catalog Number:P1382-2ug
                                   P1382-10ug

Description:

IL-12 is a potent regulator of cell-mediated immune responses and it induces IFN-γ production by NK and T cells.  It is produced by activated monocytes/macrophage cells, B lymphocytes and connective tissue-type mast cells.  Among its biological activities, IL-12 promotes the growth and activity of activated NK, CD4+ and CD8+ cells, and induces the development of IFN-γ-producing Th1 cells.  Recombinant Human IL-12 is a 75.0 kDa heterodimeric glycoprotein consisting of disulfide-linked 35 kDa (p35) and 40 kDa (p40) subunits (503 total amino acid residues).

Source:CHO cells

Synonyms:NKSF, CTL maturation factor (TCMF), Cytotoxic lymphocyte maturation factor (CLMF), TSF, IL-12p70AA Sequence:

AA Sequence:

IL-12 is a heterodimer of IL-12A and IL-12B linked through a disulfide-bond between cysteines in red in sequences below.
>IL-12 A
RNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLP

LELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQ
IFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS.
>IL-12B
IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAG
QYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTD
LTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAV
HKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGK
SKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS

Purity:Greater than 98% by SDS-PAGE gel and HPLC analyses.

Biological Activity:

The ED50 was determined by the induction of IFN-γ from NK cells co-stimulated with IL-18 is ≤ 1.0 ng/ml, corresponding to a specific activity of ≥ 1 x 106 units/mg.

Cross Reactivity:Bacteria, Human, Human + Mouse, Leech, Monkey, Mouse

Usage:FOR RESEARCH USE ONLY

Note:The product is shipped at ambient temperature. Upon receipt, store it immediately at the temperature recommended below.

Clear
SKU: P1382 Category:

Additional information

Size

2ug, 10ug

Reviews

There are no reviews yet.

Be the first to review “Recombinant Human IL-12 p70 (CHO derived)”